PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A02031.1.p
Common NameEUGRSUZ_A02031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 213aa    MW: 24059.8 Da    PI: 6.1627
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A02031.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.45e-312780255
           G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      prlrWtpeLH++F+eaveqLGG+ +AtPk+il+ m+v+gL ++hvkSHLQ+YR+
  Eucgr.A02031.1.p 27 PRLRWTPELHNHFIEAVEQLGGKYNATPKRILQRMSVEGLKISHVKSHLQMYRS 80
                      8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.42383IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-282481IPR009057Homeodomain-like
TIGRFAMsTIGR015576.6E-232781IPR006447Myb domain, plants
SuperFamilySSF466891.68E-152781IPR009057Homeodomain-like
PfamPF002492.1E-92879IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MIMTSPGAET KRSRRNEVRR YNKSEVPRLR WTPELHNHFI EAVEQLGGKY NATPKRILQR  60
MSVEGLKISH VKSHLQMYRS SKDGSKVANV VLWPWEGSHV YKANHQQNDE PRIICTNRVV  120
ETECYGWPLQ TKKVDDNEYE EAQTSGQEGD GELSENCELS LSFNSSVTTQ CVAAEDKEPS  180
WPLVVDDPIS QSGSDSGNHP PQAIRLNLDL NI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A02031.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010054008.11e-159PREDICTED: probable transcription factor KAN4
TrEMBLA0A059DH261e-159A0A059DH26_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.12e-25G2-like family protein